PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_31580V3.1.p
Common Namecol1, PHYPADRAFT_226604, PpCOL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family CO-like
Protein Properties Length: 359aa    MW: 38836.8 Da    PI: 6.1274
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_31580V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.51.8e-05343438
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                       + C+ ++   +  fC+ +  +lC  C  + H g       H+
  Pp3c2_31580V3.1.p  3 KPCDACHVSSAAVFCRADAAYLCVGCDGKVH-GanklasrHE 43
                       57*****988*****************9999.4456666666 PP

2zf-B_box24.46.2e-084590342
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                        ++C+ +e  ++   C+ +   lC  C + +H+       H++vp+
  Pp3c2_31580V3.1.p 45 VWMCEVCEVAPAVVTCKADAASLCVACDTDIHSAnplaqrHERVPV 90
                       689*****************************66899999999986 PP

3CCT69.58.8e-24295338144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea++lRYkeKr++RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Pp3c2_31580V3.1.p 295 REARVLRYKEKRQKRKFEKTIRYASRKAYAESRPRIKGRFAKRT 338
                        9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.399147IPR000315B-box-type zinc finger
SMARTSM003365.9E-8147IPR000315B-box-type zinc finger
CDDcd000217.49E-5447No hitNo description
PROSITE profilePS5011910.3674390IPR000315B-box-type zinc finger
PfamPF006432.3E-64590IPR000315B-box-type zinc finger
CDDcd000211.09E-74690No hitNo description
SMARTSM003361.4E-94890IPR000315B-box-type zinc finger
PfamPF062031.3E-17295337IPR010402CCT domain
PROSITE profilePS5101716.46295337IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MPKPCDACHV SSAAVFCRAD AAYLCVGCDG KVHGANKLAS RHERVWMCEV CEVAPAVVTC  60
KADAASLCVA CDTDIHSANP LAQRHERVPV TPLFESASPL RGPDFCVLVS ENGCHDLLKG  120
CEDASVVEAV SWLLPHPKIS TNSIIRGSAA ADEMGSSPFH DRPFSPKPKK QKVELPADIF  180
SDVDPFLDLD DATVTGIQPD SLVPVHMPEC SEDTDSLAHS MDPSFTKFPL SAKSGYSYGT  240
STLTQSISCS SLDAAVVPDS SLSDISTPYL DSQSSQDMSA RLPHQTGGPI DTVDREARVL  300
RYKEKRQKRK FEKTIRYASR KAYAESRPRI KGRFAKRTDS DMEQFGSVDS SFGVVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.39730.0gametophore| protonema| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1859250.0AB185925.1 Physcomitrella patens PpCOL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001783619.10.0predicted protein
SwissprotQ940T94e-87COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLQ5H7P00.0Q5H7P0_PHYPA; CONSTANS-like 1
STRINGPP1S371_27V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.17e-88CONSTANS-like 4
Publications ? help Back to Top
  1. Shimizu M,Ichikawa K,Aoki S
    Photoperiod-regulated expression of the PpCOL1 gene encoding a homolog of CO/COL proteins in the moss Physcomitrella patens.
    Biochem. Biophys. Res. Commun., 2004. 324(4): p. 1296-301
    [PMID:15504355]
  2. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]